DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Klk11

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:266 Identity:77/266 - (28%)
Similarity:114/266 - (42%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIESFLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTA 65
            |.|..|:.|.    |..|.|. .|.|||.|........||||:|......:||.::.:...::||
  Rat    30 MMILRFIALA----LVTGHVG-GETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTA 89

  Fly    66 AHC------FFDEEGNRLDDQGYQVRAGSALTDS------NGTLVDVAALIIHEEYAFDLNINDI 118
            |||      ....|.|.....|.:.|  ...|:|      |.:|.       ::::.     |||
  Rat    90 AHCRKPHYVILLGEHNLEKTDGCEQR--RMATESFPHPGFNNSLP-------NKDHR-----NDI 140

  Fly   119 AIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNL-YPTHLQGLALHIKSIF 182
            .:|::|:|...|..|:|:.|:.......:..|:||||.:    .|..| .|..|:...:.|....
  Rat   141 MLVKMSSPAFITRAVRPLTLSSLCVTAGTSCLISGWGTT----SSPQLRLPHSLRCANVSIIGHK 201

  Fly   183 SCRLFDP-----SLLCAGT--YGRTACHGDSGGPLVVNKQLVGVVSWGRKGCV---SSAFFVSVP 237
            .|....|     ::|||..  .|:.:|.||||||||.|..|.|::|||:..|.   ....:..|.
  Rat   202 ECERAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVC 266

  Fly   238 YFREWI 243
            .:.:||
  Rat   267 KYFDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 67/239 (28%)
Tryp_SPc 27..243 CDD:238113 66/238 (28%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 67/239 (28%)
Tryp_SPc 51..275 CDD:238113 68/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.