DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Hpn

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_038958880.1 Gene:Hpn / 29135 RGDID:61982 Length:559 Species:Rattus norvegicus


Alignment Length:255 Identity:95/255 - (37%)
Similarity:125/255 - (49%) Gaps:45/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS-A 89
            ||:||:...:.:.||||||:|.|.|:||||:.|.:.::||||||  .|.||:..: ::|.||: |
  Rat   203 RIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLLSGDWVLTAAHCF--PERNRVLSR-WRVFAGAVA 264

  Fly    90 LTDSNGTLVDVAALIIHEEY------AFDLNINDIAIVRLSTPLEFTSKVQPI--PLAKTNPYPR 146
            .|..:...:.|.|:|.|..|      ..|.|.||||:|.||:.|..|..:||:  |.|.......
  Rat   265 RTSPHAVQLGVQAVIYHGGYLPFRDPTIDENSNDIALVHLSSSLPLTEYIQPVCLPAAGQALVDG 329

  Fly   147 SIALVSGWGVSYILNDSTNLYPTH---LQGLALHIKSIFSCRLFD-------PSLLCAGTY---G 198
            .:..|:|||       :|..|...   ||...:.|.|...|...|       |.:.||| |   |
  Rat   330 KVCTVTGWG-------NTQFYGQQAVVLQEARVPIISNEVCNSPDFYGNQIKPKMFCAG-YPEGG 386

  Fly   199 RTACHGDSGGPLVVNK--------QLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAI 247
            ..||.||||||.|...        :|.|:|||| .||.   ....:..|..|||||..||
  Rat   387 IDACQGDSGGPFVCEDRISGTSRWRLCGIVSWG-TGCALARKPGVYTKVIDFREWIFQAI 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 91/249 (37%)
Tryp_SPc 27..243 CDD:238113 90/248 (36%)
HpnXP_038958880.1 Hepsin-SRCR 92..200 CDD:401275
Tryp_SPc 204..441 CDD:238113 90/248 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.