DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss29

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:247 Identity:77/247 - (31%)
Similarity:118/247 - (47%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIGGEPIGIEQVPWQVSLQYF------GDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVR 85
            |:||......:.||||||:.:      ..|:|||||.....::|||||..:.:.   |...:::.
  Rat    31 IVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDA---DPSAFRIY 92

  Fly    86 AGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPL--AKTNPYPRSI 148
            .|.........|:.|:.:|||.::......:|:|:::|:..:.....|:|:.|  |......:.:
  Rat    93 LGQVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKLSPASLEVTKKDV 157

  Fly   149 ALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC---------------RLFDPSLLCAGTYG 198
            ..|:||| |..:::|.. .|..||.:.:.|.....|               ||....:||||::|
  Rat   158 CWVTGWG-SVSMHESLP-PPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQDMLCAGSHG 220

  Fly   199 RTACHGDSGGPLVVNK----QLVGVVSWGRKGCVSS---AFFVSVPYFREWI 243
            |.:|:||||||||.|.    .|||||||| .||...   ..:..|.:|..||
  Rat   221 RDSCYGDSGGPLVCNVTGSWTLVGVVSWG-YGCALKDIPGVYARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/245 (31%)
Tryp_SPc 27..243 CDD:238113 75/245 (31%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.