DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and LOC286960

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:243 Identity:78/243 - (32%)
Similarity:115/243 - (47%) Gaps:34/243 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS 88
            :.:|:||.......||:||||.....|.||||:.|:..:::||||:..:...||.:....|..|.
  Rat    21 DDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGG 85

  Fly    89 ALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIA---- 149
            .      ..:|...:|.|.||..|...|||.:::|.:|....|:|..:.|      |||.|    
  Rat    86 E------QFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSL------PRSCASTDA 138

  Fly   150 --LVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP-----SLLCAGTY--GRTACHGD 205
              ||||||.:..:...   ||..||.|...:.|..||:...|     ::.|.|..  |:.:|.||
  Rat   139 QCLVSGWGNTVSIGGK---YPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGD 200

  Fly   206 SGGPLVVNKQLVGVVSWG----RKGCVSSAFFVSVPYFREWILNAIAS 249
            ||||:|.|.::.|:||||    .:|  ....:..|..:..||...:|:
  Rat   201 SGGPVVCNGEIQGIVSWGSVCAMRG--KPGVYTKVCNYLSWIQETMAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/233 (32%)
Tryp_SPc 27..243 CDD:238113 75/232 (32%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 75/233 (32%)
Tryp_SPc 24..243 CDD:238113 77/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.