DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss3b

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:254 Identity:85/254 - (33%)
Similarity:126/254 - (49%) Gaps:24/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLALDFLSAG---QVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFF 70
            |:.|.||.|.   .::..:.:|:||.......:|:||||. .|.|.||||:.:...:|:||||:.
  Rat     4 LIFLAFLGAAVALPLDDDDDKIVGGYTCQKNSLPYQVSLN-AGYHFCGGSLINSQWVVSAAHCYK 67

  Fly    71 DEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQP 135
            .....||.:....|..|..      ..:|.|.:|.|..|..:...|||.:::|::|....|:|..
  Rat    68 SRIQVRLGEHNIDVVEGGE------QFIDAAKIIRHPSYNANTFDNDIMLIKLNSPATLNSRVST 126

  Fly   136 IPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP-----SLLCAG 195
            :.|.::.....:..||||||.:  |:..|| ||:.||.|...:.|..||:...|     ::.|.|
  Rat   127 VSLPRSCGSSGTKCLVSGWGNT--LSSGTN-YPSLLQCLDAPVLSDSSCKSSYPGKITSNMFCLG 188

  Fly   196 TY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSS---AFFVSVPYFREWILNAIAS 249
            ..  |:.:|.||||||:|.|.||.|||||| .||...   ..:..|..:..||...:|:
  Rat   189 FLEGGKDSCQGDSGGPVVCNGQLQGVVSWG-YGCAQKGKPGVYTKVCNYVNWIQQTVAA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/226 (34%)
Tryp_SPc 27..243 CDD:238113 77/225 (34%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 77/226 (34%)
Tryp_SPc 25..243 CDD:238113 79/228 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.