DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Tmprss5

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:248 Identity:87/248 - (35%)
Similarity:124/248 - (50%) Gaps:38/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG--- 87
            ||:||:.:...:.|||.|:.....|.||.|:.:...:||||||.:....:||  ..::|.||   
  Rat   207 RIVGGQAVASGRWPWQASVMLGSRHTCGASVLAPYWVVTAAHCMYSFRLSRL--SSWRVHAGLVS 269

  Fly    88 -SALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPL-AKTNPYPR-SIA 149
             ||:....||:|:  .:|.|..|:...:..|:|:::|.||:.|:..|..:.| ||...:|: |..
  Rat   270 HSAVRQHQGTMVE--KIIPHPLYSAQNHDYDVALLQLRTPINFSDTVSAVCLPAKEQHFPQGSQC 332

  Fly   150 LVSGWGVSYILNDSTNLYPTH----LQGLALHIKSIFSCR---LFDPSL----LCAGTY-GRT-A 201
            .|||||       .|:...||    ||...:.:.|...|.   ::..:|    ||||.. ||. |
  Rat   333 WVSGWG-------HTDPSHTHSSDTLQDTMVPLLSTDLCNSSCMYSGALTHRMLCAGYLDGRADA 390

  Fly   202 CHGDSGGPLVVNK----QLVGVVSWGRKGCVS---SAFFVSVPYFREWILNAI 247
            |.||||||||...    .||||||||| ||..   ...:..|..|.:||.:.:
  Rat   391 CQGDSGGPLVCPSGDTWHLVGVVSWGR-GCAEPNRPGVYAKVAEFLDWIHDTV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 85/242 (35%)
Tryp_SPc 27..243 CDD:238113 84/241 (35%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055
Tryp_SPc 208..441 CDD:238113 86/244 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.