DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss2

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:239 Identity:79/239 - (33%)
Similarity:121/239 - (50%) Gaps:27/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS 88
            :.:|:||.......||:||||. .|.|.||||:.::..:|:||||:......||.:....|..| 
  Rat    21 DDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEG- 83

  Fly    89 ALTDSNGTLVDVAALIIHEEYAFD---LNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIAL 150
                 |...|:.|.:|.|..  ||   || |||.:::||:|::..::|..:.|..:.....:..|
  Rat    84 -----NEQFVNAAKIIKHPN--FDRKTLN-NDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCL 140

  Fly   151 VSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP-----SLLCAGTY--GRTACHGDSGG 208
            :||||.:  |:...| .|..||.|...:.....|....|     :::|.|..  |:.:|.|||||
  Rat   141 ISGWGNT--LSSGVN-EPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGG 202

  Fly   209 PLVVNKQLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAIAS 249
            |:|.|.:|.|:|||| .||.   :...:..|..:.:||.:.||:
  Rat   203 PVVCNGELQGIVSWG-YGCALPDNPGVYTKVCNYVDWIQDTIAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/229 (33%)
Tryp_SPc 27..243 CDD:238113 75/228 (33%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 75/229 (33%)
Tryp_SPc 24..242 CDD:238113 77/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.