DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG30031

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster


Alignment Length:257 Identity:97/257 - (37%)
Similarity:139/257 - (54%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLAL------DFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVT 64
            |::||:.      ..:..|.:.:.:.||:||....|...|||:|||..|.|.|||||||.|:|||
  Fly     4 FVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVT 68

  Fly    65 AAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEF 129
            ||||......:.|     |:||||:...|.|....|::...||.|..:..:|||||::::..|.|
  Fly    69 AAHCLQSVSASVL-----QIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTF 128

  Fly   130 TSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC--------RL 186
            :|.::.|.||.:||...:.|.|||||.   |:..::..|:.||.:.::|.|...|        ..
  Fly   129 SSTIKAIGLASSNPANGAAASVSGWGT---LSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ 190

  Fly   187 FDPSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILN 245
            ...:::||...|:.||.||||||||....|||||||| .||..|.:   :..|...|.|:::
  Fly   191 IRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWVIS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 92/227 (41%)
Tryp_SPc 27..243 CDD:238113 91/226 (40%)
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 92/227 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443217
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.