DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss42

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_694739.1 Gene:Prss42 / 235628 MGIID:2665280 Length:335 Species:Mus musculus


Alignment Length:251 Identity:70/251 - (27%)
Similarity:122/251 - (48%) Gaps:43/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG--S 88
            :|:||......:.|||||::....||||||:.:...::|||||.:    :|:.   |.|:.|  |
Mouse    78 KIMGGVDAEEGKWPWQVSVRVRHMHVCGGSLINSQWVLTAAHCIY----SRIQ---YNVKVGDRS 135

  Fly    89 ALTDSNGTLVDVAALIIHEEYAFDLNI-NDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIAL-- 150
            ....:...::.:..:.:|.:::..:.: ||||:::|..|:.||:.:.|:.: .:..:|.....  
Mouse   136 VYRQNTSLVIPIKTIFVHPKFSTTIVVKNDIALLKLQHPVNFTTNIYPVCI-PSESFPVKAGTKC 199

  Fly   151 -VSGWG------------VSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDPSLLCAGTY---GR 199
             |:|||            :...::.:..||....:.|.....|  |..|....::|.  |   |:
Mouse   200 WVTGWGKLVPGAPDVPTEILQEVDQNVILYEECNEMLKKATSS--SVDLVKRGMVCG--YKERGK 260

  Fly   200 TACHGDSGGPL---VVNKQL-VGVVSW----GRKGCVSSAFFVSVPYFREWILNAI 247
            .||.||||||:   ..||.: ||||||    ||||  ....:..|.::.:|::..:
Mouse   261 DACQGDSGGPMSCEFENKWVQVGVVSWGISCGRKG--YPGVYTDVAFYSKWLIAVV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 69/245 (28%)
Tryp_SPc 27..243 CDD:238113 69/244 (28%)
Prss42NP_694739.1 Tryp_SPc 78..309 CDD:214473 69/244 (28%)
Tryp_SPc 79..310 CDD:238113 69/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.