DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CELA3B

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_031378.1 Gene:CELA3B / 23436 HGNCID:15945 Length:270 Species:Homo sapiens


Alignment Length:280 Identity:82/280 - (29%)
Similarity:117/280 - (41%) Gaps:52/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SFLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGD----HVCGGSIYSENIIVTA 65
            |.|||:|:........:|...|::.||.......||||||||...    |.||||:.:.:.:|||
Human     7 SSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTA 71

  Fly    66 AHCFFDEEGNRLDDQGYQVRAGS---ALTDSNGTLVDVAA--LIIHEEYAFDLNI--NDIAIVRL 123
            .||.       ...:.|||..|.   |:.:....::.:.:  |.:|..:......  ||||:::|
Human    72 GHCI-------SSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKL 129

  Fly   124 STPLEFTSKVQPIPLAKTNP----YPRSI-ALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFS 183
            |...:....||   ||...|    .|... ..::|||..|    :....|..||...|.:.....
Human   130 SRSAQLGDAVQ---LASLPPAGDILPNETPCYITGWGRLY----TNGPLPDKLQEALLPVVDYEH 187

  Fly   184 CRLFD-------PSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVS--SAF------- 232
            |..::       .:::|||...|:.|:|||||||....:..|   |...|..|  |||       
Human   188 CSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGG---WQVHGVTSFVSAFGCNTRRK 249

  Fly   233 ---FVSVPYFREWILNAIAS 249
               |..|..|.:||...|||
Human   250 PTVFTRVSAFIDWIEETIAS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 71/251 (28%)
Tryp_SPc 27..243 CDD:238113 70/250 (28%)
CELA3BNP_031378.1 Tryp_SPc 28..263 CDD:214473 71/251 (28%)
Tryp_SPc 29..266 CDD:238113 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.