DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and TPSD1

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:234 Identity:70/234 - (29%)
Similarity:111/234 - (47%) Gaps:37/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSA--------GQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGD---HVCGGSIYSEN 60
            ||||||..|::        ||..: :..|:||:.....:.||||||:..|.   |.||||:....
Human    11 LLLLALPVLASPAYVAPAPGQALQ-QTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIHPQ 74

  Fly    61 IIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLST 125
            .::|||||.   |.:..|....:|:...........|:.|:.:|:|.::.......|||::.|..
Human    75 WVLTAAHCV---EPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEE 136

  Fly   126 PLEFTSKVQPI---PLAKTNPYPRSIALVSGWGVSYILNDSTNL---YP----------THLQGL 174
            |:..:|.:..:   |.::|.| |.....|:|||   .::::.:|   ||          .||...
Human   137 PVNISSHIHTVTLPPASETFP-PGMPCWVTGWG---DVDNNVHLPPPYPLKEVEVPVVENHLCNA 197

  Fly   175 ALH--IKSIFSCRLFDPSLLCAGTYGRTACHGDSGGPLV 211
            ..|  :.:..|.::....:||||:....:|.||||||||
Human   198 EYHTGLHTGHSFQIVRDDMLCAGSENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 61/207 (29%)
Tryp_SPc 27..243 CDD:238113 61/206 (30%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 61/206 (30%)
Tryp_SPc 38..240 CDD:214473 61/206 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.