DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Try4

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:238 Identity:76/238 - (31%)
Similarity:119/238 - (50%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS 88
            :.:|:||.......||:||||. .|.|.||||:.::..:|:||||:......||.:....|..| 
Mouse    21 DDKIVGGYTCRENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEG- 83

  Fly    89 ALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSG 153
                 |...|:.|.:|.|..:......|||.:::|::|:...::|..:.|..:.....:..|:||
Mouse    84 -----NEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTLNARVATVALPSSCAPAGTQCLISG 143

  Fly   154 WG--VSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP-----SLLCAGTY--GRTACHGDSGGP 209
            ||  :|:.:|:     |..||.|...:.....|....|     :::|.|..  |:.:|.||||||
Mouse   144 WGNTLSFGVNN-----PDLLQCLDAPLLPQADCEASYPGKITNNMICVGFLEGGKDSCQGDSGGP 203

  Fly   210 LVVNKQLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAIAS 249
            :|.|.||.|:|||| .||.   :...:..|..:.:||.|.||:
Mouse   204 VVCNGQLQGIVSWG-YGCALKDNPGVYTKVCNYVDWIQNTIAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 71/228 (31%)
Tryp_SPc 27..243 CDD:238113 71/227 (31%)
Try4NP_035776.1 Tryp_SPc 23..239 CDD:214473 71/228 (31%)
Tryp_SPc 24..242 CDD:238113 73/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.