DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss2

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:255 Identity:84/255 - (32%)
Similarity:130/255 - (50%) Gaps:23/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SFLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCF 69
            |.||:|||...:.......:.:|:||.......||:||||. .|.|.||||:.::..:|:||||:
Mouse     2 SALLILALVGAAVAFPVDDDDKIVGGYTCRESSVPYQVSLN-AGYHFCGGSLINDQWVVSAAHCY 65

  Fly    70 FDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEY-AFDLNINDIAIVRLSTPLEFTSKV 133
            ......||.:....|..|      |...||.|.:|.|..| ::.|: |||.:::|::|:...::|
Mouse    66 KYRIQVRLGEHNINVLEG------NEQFVDSAKIIRHPNYNSWTLD-NDIMLIKLASPVTLNARV 123

  Fly   134 QPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP-----SLLC 193
            ..:||..:.....:..|:||||.:  |::..| .|..||.:...:.....|....|     :::|
Mouse   124 ASVPLPSSCAPAGTQCLISGWGNT--LSNGVN-NPDLLQCVDAPVLPQADCEASYPGDITNNMIC 185

  Fly   194 AGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAIA 248
            .|..  |:.:|.||||||:|.|.:|.|:|||| .||.   :...:..|..:.:||.|.||
Mouse   186 VGFLEGGKDSCQGDSGGPVVCNGELQGIVSWG-YGCAQPDAPGVYTKVCNYVDWIQNTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 73/227 (32%)
Tryp_SPc 27..243 CDD:238113 73/226 (32%)
Prss2NP_033456.1 Tryp_SPc 23..239 CDD:214473 73/227 (32%)
Tryp_SPc 24..242 CDD:238113 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.