DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss40

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_033382.2 Gene:Prss40 / 21756 MGIID:1270857 Length:365 Species:Mus musculus


Alignment Length:263 Identity:81/263 - (30%)
Similarity:127/263 - (48%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSAGQV---NRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNR 76
            ||..:|   .:::.:|.||:..|.|:.|||.||:.:|.|:||..:..:|.:::|||||...:   
Mouse    54 LSLSEVCGKTKFQGKIYGGQIAGAERWPWQASLRLYGRHICGAVLIDKNWVLSAAHCFQRSQ--- 115

  Fly    77 LDDQGYQVRAGSALTDSN-----GTLVDVAALIIHEEY-AFDLNINDIAIVRLSTPLEFTSKVQP 135
             :...|.|..|  .||.|     ...:.|..:|:|::| .|....:||.:::|.:.:|::|.:.|
Mouse   116 -EPSDYHVMLG--YTDLNSPTRYSRTMSVQKVIVHKDYNRFHTQGSDIVLLQLRSSVEYSSHILP 177

  Fly   136 IPLAKTN-PYPRSIAL-VSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP--------- 189
            ..:.:.| ..|:..|. .||||  |:..|.....|..|....|.|.|...|:.|.|         
Mouse   178 ACVPEENIKIPKEKACWASGWG--YLREDVRIPLPNELYEAELIIMSNDQCKGFFPPPVPGSGRS 240

  Fly   190 -----SLLCAGTY--GRTACHGDSGGPLVV----NKQLVGVVSWG---RKGCVSSAFFVSVPYFR 240
                 .::||..|  .::.|.||||||||.    :..:||:.||.   .:..||.:.|..|.||.
Mouse   241 YYIYDDMVCAADYDMSKSICAGDSGGPLVCLLEGSWYVVGLTSWSSTCEEPIVSPSVFARVSYFD 305

  Fly   241 EWI 243
            :||
Mouse   306 KWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 76/247 (31%)
Tryp_SPc 27..243 CDD:238113 76/246 (31%)
Prss40NP_033382.2 Tryp_SPc 68..308 CDD:214473 76/247 (31%)
Tryp_SPc 69..311 CDD:238113 78/248 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6460
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.