DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss38

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:239 Identity:78/239 - (32%)
Similarity:120/239 - (50%) Gaps:30/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG-SA 89
            :::|||.....:.||||||.|.|.|:|||||.|...:::|||||  :.|.:|:.  |.:..| :.
Mouse    55 KLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCF--DRGKKLET--YDIYVGITN 115

  Fly    90 LTDSN--GTLVDVAALIIHEEYAFDLNI-NDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIAL- 150
            |..:|  ....::..:|||..:.....| .|:|:|:|.:.:.|:..|.||.|..::.|..:::. 
Mouse   116 LEKANRHTQWFEIYQVIIHPTFQMYHPIGGDVALVQLKSAIVFSDFVLPICLPPSDLYLINLSCW 180

  Fly   151 VSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFD-------PSLLCAGTYG--RTACHGDS 206
            .:|||:.....::.|    .|....|.:...|.|:|..       |.:|||....  :..|.|||
Mouse   181 TTGWGMISPQGETGN----ELLEAQLPLIPRFQCQLLYGLSSYLLPEMLCAADIKTMKNVCEGDS 241

  Fly   207 GGPLVVNKQ----LVGVVSWGRKGCVSSAF---FVSVPYFREWI 243
            |.|||..:.    .:|:||||| ||....:   |.:|.||..||
Mouse   242 GSPLVCKQNQTWLQIGIVSWGR-GCAQPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 76/237 (32%)
Tryp_SPc 27..243 CDD:238113 76/236 (32%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 78/236 (33%)
Tryp_SPc 58..284 CDD:214473 76/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.