DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Tmprss4

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_663378.1 Gene:Tmprss4 / 214523 MGIID:2384877 Length:435 Species:Mus musculus


Alignment Length:254 Identity:90/254 - (35%)
Similarity:124/254 - (48%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEE 73
            |::|..|..|:..: ..|::||....::..|||||:||...|||||||...:.|:||||||    
Mouse   186 LVSLRCLDCGKSLK-TPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCF---- 245

  Fly    74 GNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPI-- 136
            ...||...::|||||.:. .|...:.||.:.|.|.........|||:|:|..||.|:..|:||  
Mouse   246 RKYLDVSSWKVRAGSNIL-GNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICL 309

  Fly   137 PLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFD-------PSLLCA 194
            |.:.....|.:...|.|||  :...:...:....||.....|.|. .|...|       ..:|||
Mouse   310 PFSDEVLVPATPVWVIGWG--FTEENGGKMSDMLLQASVQVIDST-RCNAEDAYEGEVTAEMLCA 371

  Fly   195 GT--YGRTACHGDSGGPLVVNK---QLVGVVSWGRKGC---VSSAFFVSVPYFREWILN 245
            ||  .|:..|.|||||||:.:.   |:||:||||. ||   .:...:..|..:..||.|
Mouse   372 GTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGH-GCGGPSTPGVYTKVTAYLNWIYN 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 83/233 (36%)
Tryp_SPc 27..243 CDD:238113 82/232 (35%)
Tmprss4NP_663378.1 LDLa 56..90 CDD:238060
SRCR_2 106..195 CDD:295335 3/8 (38%)
Tryp_SPc 202..427 CDD:214473 83/233 (36%)
Tryp_SPc 203..430 CDD:238113 85/236 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.