DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and ELANE

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001963.1 Gene:ELANE / 1991 HGNCID:3309 Length:267 Species:Homo sapiens


Alignment Length:237 Identity:68/237 - (28%)
Similarity:104/237 - (43%) Gaps:44/237 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS-AL 90
            |:||........|:.||||..|.|.||.::.:.|.:::||||..:     ::.:..:|..|: .|
Human    30 IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVAN-----VNVRAVRVVLGAHNL 89

  Fly    91 TDSNGTLVDVAALIIHEEYAFDLN-INDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSI-----A 149
            :....|....|...|.|.....:| :|||.|::|:......:.||   :|:.....|.:     .
Human    90 SRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQ---VAQLPAQGRRLGNGVQC 151

  Fly   150 LVSGW-------GVSYILNDSTNLYPTHLQGLALHIKSIFS-CRLFDPSLLCAGTYGRTA--CHG 204
            |..||       |::.:|.:             |::..:.| ||   .|.:|....||.|  |.|
Human   152 LAMGWGLLGRNRGIASVLQE-------------LNVTVVTSLCR---RSNVCTLVRGRQAGVCFG 200

  Fly   205 DSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWI 243
            |||.|||.|..:.|:.|:.|.||.|..:   |..|..|..||
Human   201 DSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 66/235 (28%)
Tryp_SPc 27..243 CDD:238113 66/235 (28%)
ELANENP_001963.1 Tryp_SPc 30..245 CDD:238113 68/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.