DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and try-6

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001361988.1 Gene:try-6 / 185959 WormBaseID:WBGene00006624 Length:343 Species:Caenorhabditis elegans


Alignment Length:269 Identity:61/269 - (22%)
Similarity:102/269 - (37%) Gaps:95/269 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSL----------QYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLD 78
            :.:|..|....|::.||.|.:          :.:..| |.|::.|...|:||.||          
 Worm    38 KSKIFNGRKAEIDEAPWAVRINTYTNVKNIDETWSKH-CSGTLTSPRHILTATHC---------- 91

  Fly    79 DQGYQVRAGSALTDSNGTLVDV----------AALIIHE-------------------EYAFDLN 114
                  .|....|:.|||::|.          :.||:.|                   :|.|..|
 Worm    92 ------AATYTETEWNGTVIDAPIYRKYCEEQSTLIVREVAASRIVVRLRNRTEIGRAKYLFMFN 150

  Fly   115 I---------------NDIAIVRLSTPLEFTSKVQPIPLA--KTNPYPRSIALVSGWGVSYILND 162
            .               :||.|:.||..:|::|:::|:.:|  ..:..|.|...:.|:|     :|
 Worm   151 YCRKIVDKNAYEIQYPDDIMIIELSEDVEYSSELKPVCVAGNTDDNAPNSHLDLFGFG-----DD 210

  Fly   163 STNLYPTHLQGL-----------ALHIKSIFSCRLFDPSLLCAGTYGRT--ACHGDS--GGPLVV 212
            .....|:.|:.|           .:.:....:.:..||.|..|.:..||  ||.|||  ||...:
 Worm   211 PPRDKPSSLKNLHDIPLKHHKVEIMDMNKEGTSKRMDPRLFIAKSVTRTSVACPGDSGAGGVKEI 275

  Fly   213 NKQ--LVGV 219
            :|:  :|||
 Worm   276 DKRTTVVGV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 61/267 (23%)
Tryp_SPc 27..243 CDD:238113 61/266 (23%)
try-6NP_001361988.1 DUF316 7..320 CDD:367641 61/269 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.