DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and svh-1

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:244 Identity:78/244 - (31%)
Similarity:110/244 - (45%) Gaps:39/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGD--HVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG- 87
            |::||........||..:|:....  |.||.||..:..::||||||  ||..|:  ..|:|..| 
 Worm   712 RVVGGFETVPGAFPWTAALRNKATKAHHCGASILDKTHLITAAHCF--EEDERV--SSYEVVVGD 772

  Fly    88 --SALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTP-LEFTSKVQPIPL-AKTNPY-PRS 147
              :..||.|..:..:..:..:..|. |:..:||||:.:..| :||....|||.| :|...| |..
 Worm   773 WDNNQTDGNEQIFYLQRIHFYPLYK-DIFSHDIAILEIPYPGIEFNEYAQPICLPSKDFVYTPGR 836

  Fly   148 IALVSGWGVSYILNDSTNL-YPTHLQGLALHIKSIFSC----RLFDP---SLLCAGTY--GRTAC 202
            ..:|||||       |..| |...||...:.|.:.|.|    :::..   |..|||..  |..:|
 Worm   837 QCVVSGWG-------SMGLRYAERLQAALIPIINRFDCVNSSQIYSSMSRSAFCAGYLEGGIDSC 894

  Fly   203 HGDSGGPLVVNKQ-----LVGVVSWGRKGCVSS---AFFVSVPYFREWI 243
            .||||||....::     |.||:||| .||...   ..:..|..:..||
 Worm   895 QGDSGGPFACRREDGAFVLAGVISWG-DGCAQKKQPGIYTMVAPYLSWI 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 76/242 (31%)
Tryp_SPc 27..243 CDD:238113 75/241 (31%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 77/243 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.