DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and F25E5.4

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001379698.1 Gene:F25E5.4 / 179133 WormBaseID:WBGene00017785 Length:425 Species:Caenorhabditis elegans


Alignment Length:310 Identity:64/310 - (20%)
Similarity:104/310 - (33%) Gaps:103/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDF--LSAGQVNRWEQRI--------------IGGEPIGIEQVPWQVSLQYFGDHVCGGS 55
            ||:|.:.|  :.||:::.....|              |.|:.......||.||:....:......
 Worm     5 LLVLTILFTAVCAGKLDEKHNEILQLKCGIKGSQREFINGDTARPGDHPWAVSVYVKANTTSKNG 69

  Fly    56 IY-SENIIVTAAHCFFDEEGNRLDDQ----GYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNI 115
            :: ....:::|.|.........:|.:    |.:...|:.    ||...:::.   .|.|.||.:.
 Worm    70 VFLGPGTLISARHVLTFNSIKVVDGKRRILGQEEVNGAC----NGNHFELSQ---DEMYHFDYDF 127

  Fly   116 NDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPT------HLQGL 174
            ....        .|.||         ..:..:||.|      ||:|...:..|.      .|:..
 Worm   128 EHFK--------NFDSK---------RDFKNTIASV------YIINGCQSSPPPATLLMFELKES 169

  Fly   175 ALHIKSIF------SCRLFDPS-----------LLCAGTYGRT-------------------ACH 203
            |||.|..:      |.:.||.|           .|.:|.:..|                   .|.
 Worm   170 ALHNKKGYPVCISNSPKHFDASDFEVFGLNQQGRLVSGAFAPTNCTATAPFSCAHAVKQNQGLCS 234

  Fly   204 GDSGGPLVV---NK-QLVGVVSWGRKGCVS-----SAF-FVSVPYFREWI 243
            ||.||..|.   |: .::|..:.|.|.|.:     .|| |:::.|:||.|
 Worm   235 GDFGGSAVSRIDNRFTMLGFFAQGNKNCKAKPETLEAFKFLNIGYYREEI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 57/287 (20%)
Tryp_SPc 27..243 CDD:238113 57/286 (20%)
F25E5.4NP_001379698.1 DUF316 5..291 CDD:367641 64/310 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.