DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CFD

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:266 Identity:72/266 - (27%)
Similarity:119/266 - (44%) Gaps:31/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESFLLLLALDFLSAGQVNRW------EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENII 62
            |...:|:.|...:.|: ..|      ..||:||........|:..|:|..|.|:|||.:.:|..:
Human     5 ERLAVLVLLGAAACGE-EAWAWAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWV 68

  Fly    63 VTAAHCFFDEEGNRLDDQGYQVRAGS---ALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLS 124
            ::||||..|....::     ||..|:   :..:.:..|.||...:.|.:...|...:|:.:::||
Human    69 LSAAHCLEDAADGKV-----QVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLS 128

  Fly   125 TPLEFTSKVQPIPLAKT--NPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR-- 185
            ........|:|:|..:.  :..|.::..|:|||   |:|.: ...|..||.:.|.:....:|.  
Human   129 EKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWG---IVNHA-GRRPDSLQHVLLPVLDRATCNRR 189

  Fly   186 -----LFDPSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGC---VSSAFFVSVPYFREW 242
                 .....|:||.:..|.:|.||||||||....|.|||:.|.:.|   .....:..|..:..|
Human   190 THHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAW 254

  Fly   243 ILNAIA 248
            |.:.:|
Human   255 IDSVLA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 64/231 (28%)
Tryp_SPc 27..243 CDD:238113 63/230 (27%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 64/231 (28%)
Tryp_SPc 33..258 CDD:238113 65/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.