DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Klk1b5

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_032482.1 Gene:Klk1b5 / 16622 MGIID:892020 Length:261 Species:Mus musculus


Alignment Length:275 Identity:81/275 - (29%)
Similarity:111/275 - (40%) Gaps:54/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71
            :|.|||...........:.||.||........||||::..|..:.|||.:.:.|.::|||||..|
Mouse     5 ILFLALSLGGIDAAPPVQSRIFGGFNCEKNSQPWQVAVYRFTKYQCGGVLLNANWVLTAAHCHND 69

  Fly    72 EEGNRLDDQGYQVRAGSALTDSNGTLVD--------VAALIIHEEYAFDL-----------NIND 117
            :         |||..|     .|....|        |:..|.|.::...|           ..||
Mouse    70 K---------YQVWLG-----KNNFFEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSND 120

  Fly   118 IAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWG----VSYILND-----STNLYPTHLQG 173
            :.::||..|.:.|..|:||.|....|...|..|.||||    |.|...|     :..|.|.. ..
Mouse   121 LMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVIYEPADDLQCVNFKLLPNE-DC 184

  Fly   174 LALHIKSIFSCRLFDPSLLCAGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCVS---SAFF 233
            :..||:.:...      :||||..  |:..|.|||||||:.:..|.|:.|||...|..   ...:
Mouse   185 VKAHIEKVTDV------MLCAGDMDGGKDTCMGDSGGPLICDGVLHGITSWGPSPCGKPNVPGIY 243

  Fly   234 VSVPYFREWILNAIA 248
            ..:..|..||.:.||
Mouse   244 TKLIKFNSWIKDTIA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 73/249 (29%)
Tryp_SPc 27..243 CDD:238113 72/248 (29%)
Klk1b5NP_032482.1 Tryp_SPc 24..253 CDD:214473 73/249 (29%)
Tryp_SPc 25..256 CDD:238113 74/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.