DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Klk1b24

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_034773.1 Gene:Klk1b24 / 16617 MGIID:892021 Length:263 Species:Mus musculus


Alignment Length:266 Identity:75/266 - (28%)
Similarity:114/266 - (42%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71
            :|.|||...........:.|::||........||.|::..:..::|||.:.:.|.::|||||:  
Mouse     5 ILFLALSLGGIDAAPPVQSRVVGGFKCEKNSQPWHVAVFRYNKYICGGVLLNPNWVLTAAHCY-- 67

  Fly    72 EEGNRLDDQGYQVRAGSALTDSNGTLVD---VAALIIHEEYAFDL----------NINDIAIVRL 123
              ||....  |.|..|............   |:....|.:|...|          ..||:.::||
Mouse    68 --GNATSQ--YNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDDIPQPKDKSNDLMLLRL 128

  Fly   124 STPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC---- 184
            |.|.:.|..|:||.|....|...|..|.||||   .:..:....|..||.:.:.:....:|    
Mouse   129 SEPADITDAVKPIDLPTEEPKLGSTCLASGWG---SITPTKWQKPNDLQCVFIKLLPNENCTKPY 190

  Fly   185 --RLFDPSLLCAGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGC---VSSAFFVSVPYFREW 242
              ::.| .:||||..  |:..|.|||||||:.:..|.|:.|||...|   .:.|.:..:..|..|
Mouse   191 LHKVTD-VMLCAGEMGGGKDTCAGDSGGPLICDGILHGITSWGPVPCGKPNAPAIYTKLIKFASW 254

  Fly   243 ILNAIA 248
            |.:.:|
Mouse   255 IKDTMA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 68/240 (28%)
Tryp_SPc 27..243 CDD:238113 67/239 (28%)
Klk1b24NP_034773.1 Tryp_SPc 24..255 CDD:214473 68/240 (28%)
Tryp_SPc 25..258 CDD:238113 69/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.