DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and PRSS36

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:269 Identity:75/269 - (27%)
Similarity:113/269 - (42%) Gaps:79/269 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSAL 90
            ||:||........||||||.:.|.|:||||:.:.:.:::|||||.                    
Human    46 RIVGGSNAQPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFM-------------------- 90

  Fly    91 TDSNGTL------------------VD------VAALIIHEEYA-FDLNINDIAIVRLSTPLEFT 130
              :||||                  :|      |||:::...|: .:|.. |:|::||::|....
Human    91 --TNGTLEPAAEWSVLLGVHSQDGPLDGAHTRAVAAIVVPANYSQVELGA-DLALLRLASPASLG 152

  Fly   131 SKVQPI--PLAKTNPYPRSIALVSGWGVSYILNDSTNL-YPTHLQGLALHIKSIFSCR-LFD--- 188
            ..|.|:  |.|.......:....:|||   .:.::..| .|..||.:.|.:....:|: |:.   
Human   153 PAVWPVCLPRASHRFVHGTACWATGWG---DVQEADPLPLPWVLQEVELRLLGEATCQCLYSQPG 214

  Fly   189 ---------PSLLCAGTY---GRTACHGDSGGPLVVNKQ----LVGVVSWGRKGC---VSSAFFV 234
                     |.:|||| |   .|..|.||||||||..:.    ..|:.|:| .||   .....|.
Human   215 PFNLTLQILPGMLCAG-YPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFG-FGCGRRNRPGVFT 277

  Fly   235 SVPYFREWI 243
            :|..:..||
Human   278 AVATYEAWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 73/267 (27%)
Tryp_SPc 27..243 CDD:238113 72/266 (27%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 73/267 (27%)
Tryp_SPc 47..289 CDD:238113 74/268 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.