DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP001244

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_321898.3 Gene:AgaP_AGAP001244 / 1281920 VectorBaseID:AGAP001244 Length:279 Species:Anopheles gambiae


Alignment Length:211 Identity:71/211 - (33%)
Similarity:110/211 - (52%) Gaps:17/211 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSA 89
            ::|:||||:.||...:|:||:.:..|:||.||.|....:|||||.|.:.    |.:...:.||:.
Mosquito    52 KKIVGGEPVSIETHVYQLSLRSYDYHICGASIISSVWALTAAHCLFPDP----DPRTISLLAGTG 112

  Fly    90 LTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLE--FTSKVQPIPLAKTNPYPRSIALVS 152
            ...:.|.:.:...:|||..||.....||:|::|::|...  .|..:..:||. ..|.....|:|:
Mosquito   113 SQSTGGRIYNATRIIIHPMYAPSTMDNDVAVIRVNTHFSGPNTGYIGVVPLG-YEPMAGVRAIVT 176

  Fly   153 GWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR------LFDPSLLCAGTYGRTACHGDSGGPLV 211
            |||..   ::......| |.|:.:.|.....|.      |..|.::|||..|:.:|:||||||||
Mosquito   177 GWGRQ---SEGAKQSMT-LAGVEIPIVDKAECMDQWSGVLVSPQMICAGELGKDSCNGDSGGPLV 237

  Fly   212 VNKQLVGVVSWGRKGC 227
            ...:.:|:||||...|
Mosquito   238 SGGRQIGIVSWGSTKC 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 71/210 (34%)
Tryp_SPc 27..243 CDD:238113 71/209 (34%)
AgaP_AGAP001244XP_321898.3 Tryp_SPc 53..266 CDD:214473 71/210 (34%)
Tryp_SPc 54..276 CDD:238113 71/209 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.