DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP011719

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_320793.4 Gene:AgaP_AGAP011719 / 1280920 VectorBaseID:AGAP011719 Length:762 Species:Anopheles gambiae


Alignment Length:280 Identity:70/280 - (25%)
Similarity:103/280 - (36%) Gaps:87/280 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEP-----------IGIEQ----VPWQVSLQYFGDHVCGGSIYSENIIVTAAHCF---- 69
            :|.|..|.|           ||..|    |.|:          ||||:..||.|:|||||:    
Mosquito    16 DQFISSGSPAFPGEFAHIAAIGWTQPDGTVQWK----------CGGSLIWENYILTAAHCYADPD 70

  Fly    70 ---------------FDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIA 119
                           ||.:    ||:..|.|             .:..:|.|..:.......|:|
Mosquito    71 TILSPDVIRIGDLNLFDAD----DDEFVQER-------------KIVQIIRHPLHNASTVYYDLA 118

  Fly   120 IVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC 184
            :::|...:..:..|.|..|...:..|.|...|:|||.:....:.:|:    |....|.:.:...|
Mosquito   119 LLKLDKKVIQSEGVIPTCLWLDDSIPFSTLEVAGWGQTGFGKEKSNM----LLKAELKLMTNTEC 179

  Fly   185 RLFD-------------PSLLCAGTYGRTACHGDSGGPLVVNKQ--------LVGVVSWGRKGCV 228
            ..::             ...|||.......|.|||||||..|..        ||||.|:|:...|
Mosquito   180 AKYNNKRTQRRLGNDLADHQLCAWDEVMDTCPGDSGGPLHYNLYYKHTKIPFLVGVTSFGKACAV 244

  Fly   229 SS-AFFVSVPYFREWILNAI 247
            |. ..:|.|..|::||:..:
Mosquito   245 SQPGVYVKVAKFKQWIIETL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 67/272 (25%)
Tryp_SPc 27..243 CDD:238113 67/271 (25%)
AgaP_AGAP011719XP_320793.4 Tryp_SPc 19..263 CDD:238113 69/274 (25%)
Tryp_SPc 19..260 CDD:214473 67/271 (25%)
Tryp_SPc 318..537 CDD:304450
Tryp_SPc 653..>762 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.