DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP008994

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_319744.4 Gene:AgaP_AGAP008994 / 1279956 VectorBaseID:AGAP008994 Length:250 Species:Anopheles gambiae


Alignment Length:260 Identity:68/260 - (26%)
Similarity:111/260 - (42%) Gaps:63/260 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVS------LQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGY-- 82
            |::||:.....:.||||.      |..|..:.|||.:.:...::|||||          ..|:  
Mosquito     5 RVVGGKASKFGEWPWQVLVRESTWLGLFTKNKCGGVLITNEYVITAAHC----------QPGFLA 59

  Fly    83 -------QVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPL-A 139
                   :....|.|........:|..:|:|.:|......||:||:.|..|:.:...:.||.: .
Mosquito    60 SLVAVFGEFDISSDLETKRSVTKNVKRVIVHRQYDAATFENDLAILELENPIHYDVHIVPICMPG 124

  Fly   140 KTNPYPRSIALVSGWG-VSY--------------ILNDSTNLYPTHLQGLALHIKSIFSCRLFDP 189
            ....:...:|.|:||| ::|              ::.:|......|:.|   |.|.|.      |
Mosquito   125 DEADFTGRMATVTGWGRLTYGGGVPSVLQEVQVPVIENSVCQEMFHMAG---HNKKIL------P 180

  Fly   190 SLLCAGTYG---RTACHGDSGGPLVVNK-----QLVGVVSWGRKGCVS---SAFFVSVPYFREWI 243
            |.:||| |.   |.:|.||||||||:.:     :|||.||.|.: |.:   ...::...:::.|:
Mosquito   181 SFVCAG-YANGKRDSCEGDSGGPLVLQRPDGRYELVGTVSHGIR-CAAPYLPGVYMRTTFYKPWL 243

  Fly   244  243
            Mosquito   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 67/258 (26%)
Tryp_SPc 27..243 CDD:238113 66/257 (26%)
AgaP_AGAP008994XP_319744.4 Tryp_SPc 5..242 CDD:214473 67/257 (26%)
Tryp_SPc 6..246 CDD:238113 67/259 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.