DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP009828

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_318940.4 Gene:AgaP_AGAP009828 / 1279246 VectorBaseID:AGAP009828 Length:232 Species:Anopheles gambiae


Alignment Length:236 Identity:65/236 - (27%)
Similarity:99/236 - (41%) Gaps:34/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIGGEPIGIEQVPWQVSLQYFGDH--VCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSA 89
            |:||........|:.|:::.....  :|.|.:.....|:|.|.|..|:....|          ..
Mosquito     7 IVGGHASLPGAAPYIVAIKTTSASTLLCAGVLIKTTWILTTAQCVNDKTAADL----------KI 61

  Fly    90 LTDSNGTLVDVAALII-----HEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIA 149
            ||.|:..|.....|:|     |..|....:..::|:::||..:..:|:|..:.| ...|....|.
Mosquito    62 LTGSHRLLTSKELLLISKIERHPSYKPASSEYNLALLQLSAAVSLSSRVATVVL-NDEPIISGIP 125

  Fly   150 LV-SGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR----LFDPSL--LCA-GTYGRTACHGDS 206
            :| .|||.|   :..:..|...||.|.....|...||    |.|.|.  :|. |..|:.||..|.
Mosquito   126 VVFFGWGAS---SYGSLAYSNVLQSLYKRTLSTSDCRAQSGLVDLSADNICTIGQPGQAACTHDE 187

  Fly   207 GGPLV--VNKQLVGVVSWGRKGCV--SSAFFVSVPYFREWI 243
            .||||  ..::|||:.::|.: |.  |...||:|...:.||
Mosquito   188 AGPLVRYDTQKLVGLFNYGSQ-CTGRSPDVFVNVLTHKTWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 63/234 (27%)
Tryp_SPc 27..243 CDD:238113 63/234 (27%)
AgaP_AGAP009828XP_318940.4 Tryp_SPc 7..230 CDD:238113 65/236 (28%)
Tryp_SPc 7..227 CDD:214473 63/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.