DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP011427

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_317876.4 Gene:AgaP_AGAP011427 / 1278263 VectorBaseID:AGAP011427 Length:868 Species:Anopheles gambiae


Alignment Length:223 Identity:63/223 - (28%)
Similarity:91/223 - (40%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG-----SALTDSNGTLVDVAALIIHEE 108
            |::||||:.:...::|||||..|......|    .||.|     |...|.:...:.:|..|.|.:
Mosquito    46 DYLCGGSLITLKFVLTAAHCAVDYANVPPD----TVRLGDTDLASTDDDESAQQIPIARFIKHPQ 106

  Fly   109 YAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQG 173
            |.......|||:|.|:..::....|....:.:....|.::....|:|.   |.....|.|| ||.
Mosquito   107 YRESRKYYDIALVELANVVDADDAVCVACVWREPEAPTNLLDAVGFGA---LGFGEKLSPT-LQK 167

  Fly   174 LALHIKSIFSCRLFDPS------------LLCAGTYGRTACHGDSGGPLVVN---------KQLV 217
            :.|...|...|....|:            .|||.:.....|.|||||||...         ..:|
Mosquito   168 VQLRALSAVQCAERIPANRRQMPEGLRDDQLCAHSKTMDTCEGDSGGPLQTEALDVFGETYPLVV 232

  Fly   218 GVVSWGRKGCV--SSAFFVSVPYFREWI 243
            ||||:|.. |:  |:..:..|..:.|||
Mosquito   233 GVVSFGTP-CIEGSTGVYTRVSSYVEWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 61/221 (28%)
Tryp_SPc 27..243 CDD:238113 61/221 (28%)
AgaP_AGAP011427XP_317876.4 Tryp_SPc 21..261 CDD:238113 63/223 (28%)
Tryp_SPc 21..259 CDD:214473 61/221 (28%)
Tryp_SPc 306..546 CDD:238113
Tryp_SPc 306..544 CDD:214473
Tryp_SPc 625..862 CDD:214473
Tryp_SPc 630..864 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.