DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and TRY6_ANOGA

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_317175.2 Gene:TRY6_ANOGA / 1277692 VectorBaseID:AGAP008290 Length:273 Species:Anopheles gambiae


Alignment Length:244 Identity:80/244 - (32%)
Similarity:118/244 - (48%) Gaps:46/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSA 89
            :||:||..|.|...|:|:||||.|.|.|||||.:...|:|||||.     :...:....||.||:
Mosquito    45 KRIVGGFVIDISDAPYQISLQYNGKHHCGGSILNSKWILTAAHCI-----DLYSEVKPTVRVGSS 104

  Fly    90 LTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPL-AKTNPYPR-SIALVS 152
            ...:.||::.:..::.|..::...|..|||::.|...|.|...|||:.| .:.:|... ::.:||
Mosquito   105 EHAAGGTVLHLLRIVPHPGHSSGGNNYDIALLELECELTFNDNVQPVQLPEQDDPIDEGTMGIVS 169

  Fly   153 GWGVSYILND------STNLYPTHLQ-----------GLALHIKSIFSCRLFDPSLLCAGTY--- 197
            |||::....|      :||: ||..|           |:|             ..:.||| |   
Mosquito   170 GWGMTMSAADLNAILRATNV-PTVNQQECNQAYQSYGGVA-------------EQMFCAG-YKQG 219

  Fly   198 GRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWI 243
            |...|..|||||.|...:|:|||||..: |..:.:   :..|...|:||
Mosquito   220 GTGTCRNDSGGPFVAEGKLIGVVSWSHE-CALAGYPGVYARVASVRDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 78/241 (32%)
Tryp_SPc 27..243 CDD:238113 77/240 (32%)
TRY6_ANOGAXP_317175.2 Tryp_SPc 46..267 CDD:214473 78/241 (32%)
Tryp_SPc 47..270 CDD:238113 79/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.