DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and TRY7_ANOGA

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_317172.2 Gene:TRY7_ANOGA / 1277689 VectorBaseID:AGAP008293 Length:267 Species:Anopheles gambiae


Alignment Length:236 Identity:83/236 - (35%)
Similarity:122/236 - (51%) Gaps:33/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQ-----VR 85
            ||:||..|.:...|:||||||...|.||||:.:...::|||||          ..|.|     ||
Mosquito    41 RIVGGFEINVSDTPYQVSLQYINSHRCGGSVLNSKWVLTAAHC----------TDGLQAFTLTVR 95

  Fly    86 AGSALTDSNGTLVDVAALIIHEEYAFDLNIN-DIAIVRLSTPLEFTSKVQPIPLAKTNPY--PRS 147
            .||:...|:||:|:||.::.|.:|. :.|.: |.|::.|.:.|.|:..|||:.|.:.:..  ..:
Mosquito    96 LGSSRHASSGTVVNVARIVEHPKYN-EYNTDYDYALLELESELTFSDVVQPVALPEQDEAVDAGT 159

  Fly   148 IALVSGWGVSYILNDSTNL-----YPTHLQGLALHIKSIFSCRLFDPSLLCAGTY--GRTACHGD 205
            :.:|||||.:....:|..:     .||..|.   ..:..:|.......:||||..  |:.||.||
Mosquito   160 MTIVSGWGSTKSATESNAILRAANVPTVDQE---ECREAYSHDAITDRMLCAGYQQGGKDACQGD 221

  Fly   206 SGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWI 243
            ||||||.:.:|:|||||| .||....:   :..|...|.|:
Mosquito   222 SGGPLVADGKLIGVVSWG-SGCAQPGYPGVYARVAVVRNWV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 82/234 (35%)
Tryp_SPc 27..243 CDD:238113 81/233 (35%)
TRY7_ANOGAXP_317172.2 Tryp_SPc 41..261 CDD:214473 82/234 (35%)
Tryp_SPc 42..264 CDD:238113 82/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.