DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and TRY1_ANOGA

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_317170.2 Gene:TRY1_ANOGA / 1277688 VectorBaseID:AGAP008296 Length:274 Species:Anopheles gambiae


Alignment Length:231 Identity:84/231 - (36%)
Similarity:118/231 - (51%) Gaps:20/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSA 89
            |||:||..|.:...|:||||||...|.||||:.|...::|||||......:.|     .||.|::
Mosquito    46 QRIVGGFEIDVSDAPYQVSLQYNKRHNCGGSVLSSKWVLTAAHCTAGASPSSL-----TVRLGTS 105

  Fly    90 LTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPR--SIALVS 152
            ...|.||:|.||.::.|.:|.......|.:::.|...|.|:..|||:.|.|.:...:  ::..||
Mosquito   106 RHASGGTVVRVARVVQHPKYDSSSIDFDYSLLELEDELTFSDSVQPVGLPKQDETVKDGTMTTVS 170

  Fly   153 GWGVSYILNDSTNL-----YPTHLQGLALHIKSIFSCRLFDPSLLCAGTY--GRTACHGDSGGPL 210
            |||.:....:|..:     .||..|.......|.|..  ....:||||..  |:.||.|||||||
Mosquito   171 GWGNTQSAAESNAVLRAANVPTVNQKECNKAYSEFGG--VTDRMLCAGYQQGGKDACQGDSGGPL 233

  Fly   211 VVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWI 243
            |.:.:|||||||| .||..:.:   :..|...|:|:
Mosquito   234 VADGKLVGVVSWG-YGCAQAGYPGVYSRVAVVRDWV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 82/228 (36%)
Tryp_SPc 27..243 CDD:238113 81/227 (36%)
TRY1_ANOGAXP_317170.2 Tryp_SPc 47..268 CDD:214473 82/228 (36%)
Tryp_SPc 48..271 CDD:238113 82/229 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.