DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP006672

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_316708.4 Gene:AgaP_AGAP006672 / 1277262 VectorBaseID:AGAP006672 Length:327 Species:Anopheles gambiae


Alignment Length:260 Identity:80/260 - (30%)
Similarity:119/260 - (45%) Gaps:59/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYF----GDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQ--- 83
            ::.||.....:|.|..||:...    .|.:|||||.::..|:|||||.:          |.|   
Mosquito    79 KVAGGTVAKNDQFPHLVSIILIFADGSDTLCGGSILADRFILTAAHCLY----------GMQEAT 133

  Fly    84 VRAGSAL------TDSNGTLVDVAALIIHEEY-AFDLNINDIAIVRLSTPLEFTSKVQPIPLAK- 140
            :..|.::      .|.....:..|..|:|..| ..|: :||||::||..||.|:::||||.|.. 
Mosquito   134 IVPGQSVIQIPFPPDIVTVAIKPADTILHPGYDPVDI-LNDIALIRLPQPLTFSARVQPIRLPSW 197

  Fly   141 TNPYPRSI---ALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDPSLLC--------- 193
            ||.|....   ::|||||.     .|.:.|...:..:.|.::  |:.....|:.:|         
Mosquito   198 TNSYVDLTGYDSIVSGWGA-----QSNDDYAELVDEMRLDLR--FATNTIVPNAVCHRVYGSIIR 255

  Fly   194 ------AGTYGRTACHGDSGGPLVV---NKQL--VGVVSWGR-KGCVSS--AFFVSVPYFREWIL 244
                  ||..||..|.|||||||.|   .::|  ||:||:|. .||.:.  ..:..|..:.|||:
Mosquito   256 DQQICVAGEGGRNPCQGDSGGPLTVKFDGQRLTQVGIVSYGSVLGCENGVPGVYTRVSSYVEWIV 320

  Fly   245  244
            Mosquito   321  320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 78/257 (30%)
Tryp_SPc 27..243 CDD:238113 78/256 (30%)
AgaP_AGAP006672XP_316708.4 Tryp_SPc 79..319 CDD:214473 78/257 (30%)
Tryp_SPc 80..319 CDD:238113 78/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.