DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP006486

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_316523.4 Gene:AgaP_AGAP006486 / 1277090 VectorBaseID:AGAP006486 Length:287 Species:Anopheles gambiae


Alignment Length:260 Identity:64/260 - (24%)
Similarity:103/260 - (39%) Gaps:58/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LDFLSAG--QVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEG 74
            |.|::.|  .||.....|:.   :|:...|        .:..|||.|.:||.::|||.|....:.
Mosquito    38 LPFIAGGTNAVNGQFPSIVA---VGLPAPP--------NNAFCGGVILNENHVLTAARCVLTPQN 91

  Fly    75 NRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEY---AFDLNINDIAIVRLSTPLEFTSKVQPI 136
            ..|......:.:|....:.....:.:.|:.:|.:|   .|:.|   ||::|.|:  .|...|.|:
Mosquito    92 TLLFANQLNILSGMLQLNFGAPRIGITAVYVHPQYNPFTFEHN---IAVLRTSS--NFFFPVVPV 151

  Fly   137 PLAKTNPYPRSIAL------VSGWG------VSYILN------DSTNLYPTHLQGLALHIKSIFS 183
            |......:...||.      |.||.      |...:|      |:.|       |||:|:.:|  
Mosquito   152 PNVDFAQFYEEIAFDGQPCQVVGWNNGTATPVQQFINAPILNRDTCN-------GLAVHLGNI-- 207

  Fly   184 CRLFDPSLLCAG--TYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSS---AFFVSVPYFREWI 243
                ..|::|||  ..|...|..:.|..|....:|.|::|.| .||..:   ..:..:.|:..||
Mosquito   208 ----RESMVCAGVTNAGPGVCASNLGTGLFCEGRLAGILSTG-LGCGQANNPGVYTQIRYYLPWI 267

  Fly   244  243
            Mosquito   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 57/242 (24%)
Tryp_SPc 27..243 CDD:238113 57/241 (24%)
AgaP_AGAP006486XP_316523.4 Tryp_SPc 41..270 CDD:238113 62/257 (24%)
Tryp_SPc 41..267 CDD:214473 60/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.