DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP005791

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_315804.4 Gene:AgaP_AGAP005791 / 1276457 VectorBaseID:AGAP005791 Length:248 Species:Anopheles gambiae


Alignment Length:272 Identity:65/272 - (23%)
Similarity:104/272 - (38%) Gaps:59/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCG-GSIYSENIIVTAAHCF 69
            |..||.|...:.||.       |||..:.|.|.|:...:......:.| |:|.|.|.::|:|...
Mosquito     6 FATLLCLAAFAKGQQ-------IGGTDVSIAQYPFVAGILLQRSTIIGNGAILSPNWVLTSASAV 63

  Fly    70 FDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEY-AFDLNINDIAIVRLSTPLEFTSKV 133
            :.     ..|..|.:..||....:......|..:..|.|: .:|.|   :|:|::|..:.|...|
Mosquito    64 YS-----TPDSDYSIATGSEELLTPAAQYQVQRIFRHPEFVGWDYN---VALVKVSGKIAFGDTV 120

  Fly   134 QPIPLAKTNPYPRSIALVSGWGVSYILNDSTNL-YPTHLQGLALHIKSIFSCRLFD-----PSL- 191
            |.|.:|.|:|              ..:||:|.| |..:..|.: |::|.....:.|     |.| 
Mosquito   121 QSIAIATTDP--------------ETVNDATMLSYGKNEDGTS-HLRSATYTLISDNDDCVPLLQ 170

  Fly   192 -------------LC----AGTYGRTACHGDSGGPLVVNKQLVGVVSWGRK--GCVSSAFFVSVP 237
                         .|    .||. :...:.|:|.|||.:.||..|.::...  |....:....:.
Mosquito   171 EYQAKEVIWQHHGFCLIPPPGTQ-QGQWYNDAGAPLVADGQLYAVFAFAENEGGTNEGSVATRLT 234

  Fly   238 YFREWILNAIAS 249
            .|..||.:.:.|
Mosquito   235 SFAGWIQSIMFS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 56/244 (23%)
Tryp_SPc 27..243 CDD:238113 56/243 (23%)
AgaP_AGAP005791XP_315804.4 Tryp_SPc 21..243 CDD:304450 58/245 (24%)
Tryp_SPc 21..240 CDD:214473 56/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.