DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP005671

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_315688.1 Gene:AgaP_AGAP005671 / 1276351 VectorBaseID:AGAP005671 Length:300 Species:Anopheles gambiae


Alignment Length:302 Identity:80/302 - (26%)
Similarity:132/302 - (43%) Gaps:73/302 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IESFLLLLALDFLSA--------GQV-------NRWEQ---------------RIIGGEPIGIEQ 37
            :::|:||:.|..:::        .||       :.||:               ||..|:.....|
Mosquito     1 MKTFVLLVGLLAVASAEWIEIDWSQVRPIEEFDHYWERLPAEMQIYRKMLPTHRITNGQEATPGQ 65

  Fly    38 VPWQVS-LQYF--GDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVD 99
            .|:|:: |..|  |..:||||:.:...|:|||||.       :.......|.|:|:..::...|:
Mosquito    66 FPYQIALLSEFATGTGLCGGSVLTNTFILTAAHCV-------VSGATTLARGGTAIMGAHNRNVN 123

  Fly   100 ----------VAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPL---AKTNPYPRSIALV 151
                      ...:|.|.:|:.....||||:|||...:.|.::|||..|   :.|..:......|
Mosquito   124 EPSQQRIRFSTGGIIRHPQYSTTNIRNDIAVVRLDGTIVFNTRVQPARLPARSDTRQFGGFTGTV 188

  Fly   152 SGWG--------VSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDPSLLC-AGTYGRTACHGDSG 207
            ||:|        .|.::..:.|...|:...:|.     ::..|..|..:| :|..||::|:||||
Mosquito   189 SGFGRTSDGSSATSAVVRFTRNPVMTNADCIAR-----WNTALIQPQNVCLSGEGGRSSCNGDSG 248

  Fly   208 GPLVV---NKQLVGVVSWG-RKGCV--SSAFFVSVPYFREWI 243
            |||.|   ....:|:||:| ..||.  ..:.:..|.:|..||
Mosquito   249 GPLTVQDGGSLQIGIVSFGSAAGCSIGMPSVYARVSFFLPWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/247 (28%)
Tryp_SPc 27..243 CDD:238113 69/246 (28%)
AgaP_AGAP005671XP_315688.1 Tryp_SPc 54..290 CDD:214473 70/247 (28%)
Tryp_SPc 55..293 CDD:238113 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.