DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP005664

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_315684.2 Gene:AgaP_AGAP005664 / 1276347 VectorBaseID:AGAP005664 Length:306 Species:Anopheles gambiae


Alignment Length:309 Identity:84/309 - (27%)
Similarity:135/309 - (43%) Gaps:90/309 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IESFLLLLALDFLSAG-------------------------QVNRWEQ---RIIGGEPIGIEQVP 39
            :::|.||:|| |.:|.                         |:.|:.|   |::.|:.....|.|
Mosquito    10 MKTFALLVAL-FAAANADIDWSKVRPIEEFDHYWARLPQELQIYRYAQPSHRVVNGQEATPGQFP 73

  Fly    40 WQVSLQ---YFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLV--- 98
            :|::|.   ..|..:||||:.:.|.::|||||               |..|::.....|..:   
Mosquito    74 YQIALLSNFLIGTGLCGGSVLTNNYVLTAAHC---------------VIMGTSTVALGGNAIMGA 123

  Fly    99 ---------------DVAALIIHEEYAFDLNI-NDIAIVRLSTPLEFTSKVQPIPL---AKTNPY 144
                           ..|.:..|..|: ..|| ||||:|||::|:.||.::||..|   :.|..:
Mosquito   124 HNRDAPEPSQQIIAFTSAGISAHPGYS-SANIRNDIAVVRLNSPITFTDRIQPARLPARSDTRQF 187

  Fly   145 PRSIALVSGWG--------VSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDPSLLC-AGTYGRT 200
            ......|||:|        .|.::..::|...|:...:|.     ::..|.:|..:| :|..||:
Mosquito   188 GGFTGTVSGFGRTSDASQATSSVVMFTSNPVMTNADCIAQ-----WNAVLIEPQNVCMSGEGGRS 247

  Fly   201 ACHGDSGGPLVV---NKQLVGVVSWG-RKGCV--SSAFFVSVPYFREWI 243
            ||:|||||||.|   ....|||||:| ..||.  ..:.:..|.:|.::|
Mosquito   248 ACNGDSGGPLAVQDGGSLQVGVVSFGSAAGCAIGMPSVYARVSFFLDFI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 73/256 (29%)
Tryp_SPc 27..243 CDD:238113 72/255 (28%)
AgaP_AGAP005664XP_315684.2 Tryp_SPc 60..296 CDD:214473 73/256 (29%)
Tryp_SPc 61..299 CDD:238113 73/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.