DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP004858

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_314333.4 Gene:AgaP_AGAP004858 / 1275108 VectorBaseID:AGAP004858 Length:435 Species:Anopheles gambiae


Alignment Length:251 Identity:67/251 - (26%)
Similarity:100/251 - (39%) Gaps:66/251 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQ---VRAGSALTDSN 94
            ||..|....:|..      ||||:.:...::|||||       .|:|.|..   ||.|  :.|..
Mosquito     4 IGWRQTNGSISFD------CGGSLITPRHVLTAAHC-------ALNDDGVAPQVVRLG--VIDIT 53

  Fly    95 GTLVD----------VAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQP--------IPLAKT 141
            ..|.|          :::...|.|:.|....:||.:|.|..|:..|..|.|        :||   
Mosquito    54 AGLYDPQNQFAQEYGISSFRRHPEHEFRAEYHDIGLVTLDRPVTLTDAVVPACLWTGAQVPL--- 115

  Fly   142 NPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDPS----------LLCAGT 196
                |.:..| |:|.:....:.|   |..|:.....:.:....|.:.||          .:||..
Mosquito   116 ----RRLEAV-GFGQTSFGGERT---PILLKVQLSPVDNSACGRFYPPSRRRRQGLIDQQMCASD 172

  Fly   197 YGRTACHGDSGGP----LVVNKQL----VGVVSWGR-KGCVSSAFFVSVPYFREWI 243
            .....||||||||    |:.|.:|    ||:.|:|| .|..:.|.:..|..:.:|:
Mosquito   173 ERMDTCHGDSGGPLQLKLMANNRLIPFVVGITSFGRFCGTATPAVYTRVSSYVDWL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 66/249 (27%)
Tryp_SPc 27..243 CDD:238113 66/249 (27%)
AgaP_AGAP004858XP_314333.4 Tryp_SPc 1..229 CDD:238113 67/251 (27%)
Tryp_SPc 1..227 CDD:214473 66/248 (27%)
Tryp_SPc 295..>384 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.