DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP005196

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_314095.2 Gene:AgaP_AGAP005196 / 1274902 VectorBaseID:AGAP005196 Length:264 Species:Anopheles gambiae


Alignment Length:237 Identity:73/237 - (30%)
Similarity:108/237 - (45%) Gaps:25/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIGGEPIGIEQVPWQVSLQYFGDHV-CGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSAL 90
            ||||..:...:.|:...|.|..... |||||.:...|:|||||..:.....|.    .||.|:..
Mosquito    35 IIGGTDVEDGKAPYLAGLVYNNSATYCGGSIIAARWILTAAHCVTNVNVTNLT----VVRVGTND 95

  Fly    91 TDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPL-AKTNPYPRSIALVSGW 154
            ....|::..:..:|.||.|:.....||:|::||.||::|...|:.|.| .:..|...::.:| ||
Mosquito    96 NYEGGSMYQIDRVIPHERYSAITFRNDVALLRLKTPIKFEEHVEKIELNEELVPINATLTIV-GW 159

  Fly   155 GVSYILNDSTNLYPTHLQGLALHIKSIFSCR------LFDPSLLCAGTYGRTA---CHGDSGGPL 210
            |  ::..:..|  |...|.:.:....:..||      ...|..||  |:.|..   |.||||.|:
Mosquito   160 G--FVGWNKEN--PKRTQVIKVQHIGLNRCRKMANGSAIYPEHLC--TFSRAGHGPCKGDSGSPV 218

  Fly   211 VVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAIAS 249
            |...:.||||||...|..:...   ..|:.||..||...:|:
Mosquito   219 VWKGKQVGVVSWAMAGVCAIGLPDVQASIRYFYGWITKTMAA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/229 (31%)
Tryp_SPc 27..243 CDD:238113 70/229 (31%)
AgaP_AGAP005196XP_314095.2 Tryp_SPc 35..257 CDD:238113 72/232 (31%)
Tryp_SPc 35..254 CDD:214473 70/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.