DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP004568

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_313873.5 Gene:AgaP_AGAP004568 / 1274710 VectorBaseID:AGAP004568 Length:283 Species:Anopheles gambiae


Alignment Length:271 Identity:78/271 - (28%)
Similarity:122/271 - (45%) Gaps:70/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLD 78
            |.:.| .|....:|:||....|.:.||.|:|.|....:||||:.::..::|||||.|..:.:|  
Mosquito    31 FAACG-TNANNSKIVGGHEAEIGRYPWMVALYYNNRFICGGSLINDRYVLTAAHCVFGSDRSR-- 92

  Fly    79 DQGYQVRAGSALTDSNGTLVDVAALIIHE-----EYAFD-----------LNI-----NDIAIVR 122
               :.|:                 .::|:     |.:|:           ||:     ||:|:::
Mosquito    93 ---FSVK-----------------FLMHDRTVPKEDSFERKVSYIMTNWFLNVLVFITNDVALLK 137

  Fly   123 LSTPLEFTSKVQPIPL-AKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR- 185
            ||.|:.....:.|:.| .:.|.|.....:|:|||.   |.|.|  :|..||.:.:.|.|...|. 
Mosquito   138 LSEPVPLGETIIPVCLPPEGNTYAGQEGIVTGWGK---LGDGT--FPMKLQEVHVPILSNEQCHN 197

  Fly   186 -------LFDPSLLCAG--TYGRTACHGDSGGPLVV-----NKQLV-GVVSWGRKGCVSSAF--- 232
                   ..:..::|||  ..|:.:|.||||||:.|     |:.:: |||||| .||....|   
Mosquito   198 QTQYFRFQINDRMMCAGIPEGGKDSCQGDSGGPMHVFDTEANRFVIAGVVSWG-FGCAQPRFPGI 261

  Fly   233 FVSVPYFREWI 243
            :..|..|..||
Mosquito   262 YARVNRFISWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 73/257 (28%)
Tryp_SPc 27..243 CDD:238113 73/256 (29%)
AgaP_AGAP004568XP_313873.5 Tryp_SPc 42..272 CDD:214473 73/257 (28%)
Tryp_SPc 43..275 CDD:238113 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.