DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CLIPB5

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_313032.4 Gene:CLIPB5 / 1273975 VectorBaseID:AGAP004148 Length:379 Species:Anopheles gambiae


Alignment Length:285 Identity:82/285 - (28%)
Similarity:120/285 - (42%) Gaps:60/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SAGQVN-RWEQRIIGGEPIGIEQVPWQVSLQY------FGDHVCGGSIYSENIIVTAAHCFFDEE 73
            |.||.. :...||.||....|::.||...|:|      ||.| |||.:.::..::||:||.   .
Mosquito   104 SPGQCGIQTSDRIFGGVNTRIDEFPWIALLKYAKPNNVFGFH-CGGVLINDRYVLTASHCV---N 164

  Fly    74 GNRLDDQG--YQVRAG----SALTDSNGTLVDV-----------AALIIHEEY--AFDLNINDIA 119
            |..:....  .:||.|    |...|..|...||           ...|.|.||  ......||||
Mosquito   165 GKDIPSTWNLAEVRLGEWDTSTAQDCEGLGDDVDCSPPPIDVPIEGKIPHPEYVPTSAEQYNDIA 229

  Fly   120 IVRLSTPLEFTSKVQPIPL-----AKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIK 179
            ::||...:.::..::||.|     .|...|......|:|||     ..:|..:....|.:|:...
Mosquito   230 LLRLQQSVPYSDFIKPICLPMQAELKARDYVGFRMQVAGWG-----RTATARFSNVKQKVAVDGV 289

  Fly   180 SIFSCR--------LFDPSLLCA-GTYGRTACHGDSGGPLV-VNK-------QLVGVVSWGRKGC 227
            |:.:|.        |...|.||| |..|:.:|.|||||||. |:.       .|:|:||:|...|
Mosquito   290 SLDACNQVYQREQVLLRQSQLCAGGEAGKDSCQGDSGGPLTGVHTAGGLQYWYLIGLVSFGPTPC 354

  Fly   228 VSSAF---FVSVPYFREWILNAIAS 249
            ..:.:   :..|..:.:||...||:
Mosquito   355 GQAGWPGVYTKVDQYVDWITATIAA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/266 (28%)
Tryp_SPc 27..243 CDD:238113 74/265 (28%)
CLIPB5XP_313032.4 CLIP 33..87 CDD:288855
Tryp_SPc 115..373 CDD:214473 75/266 (28%)
Tryp_SPc 116..373 CDD:238113 74/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.