DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP003248

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_312959.4 Gene:AgaP_AGAP003248 / 1273921 VectorBaseID:AGAP003248 Length:296 Species:Anopheles gambiae


Alignment Length:269 Identity:70/269 - (26%)
Similarity:109/269 - (40%) Gaps:73/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QRIIGGEPIGIEQVPWQVSLQYFG-----DHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQG--- 81
            :|:|......:::.||...::|:.     .::||||:.:|..:||||||....      .||   
Mosquito    46 ERLITSLVAQLDEAPWMALIEYWKPNGSLSYLCGGSLINERYVVTAAHCVTSL------PQGWTV 104

  Fly    82 YQVRAG----SALTD-----SNGTLVDVAA--LIIHEEYAFDL--NINDIAIVRLSTPLEFTSKV 133
            :::|.|    |...|     .|...:|||.  :.:||:|....  :.||||::||...:.:|..|
Mosquito   105 HRIRLGEWDLSTSEDCDHSRCNDAPIDVAVDKITVHEDYKSPSRNHRNDIALIRLDRQMHYTETV 169

  Fly   134 QPIPLAKTNPYP----RSIALVSGW-------------GVSYILNDSTNLYPTHLQGLALHIKSI 181
            .||.|.:..|..    |::..| ||             .|...|.|..|....:||.        
Mosquito   170 APICLPQNGPLQTQRYRTMHSV-GWIEENFGPIGGKKLQVEQDLVDFQNCSSNYLQA-------- 225

  Fly   182 FSCRLFDPSLLCAGTYGRTACHGD-----SGGPLVV----NKQLVGVVSWGRK--GCVS-SAFFV 234
                    |:..|.|....|...|     :||||:.    :..|.||.|:|.:  |.|. ...:.
Mosquito   226 --------SIALADTQLCVAQQKDNRIDIAGGPLMQRIAGHWYLFGVASFGGRNYGTVELPNVYT 282

  Fly   235 SVPYFREWI 243
            :|..:.:||
Mosquito   283 NVMEYVDWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 68/266 (26%)
Tryp_SPc 27..243 CDD:238113 67/265 (25%)
AgaP_AGAP003248XP_312959.4 Tryp_SPc 53..291 CDD:214473 66/260 (25%)
Tryp_SPc 54..294 CDD:238113 68/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.