DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CLIPB8

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_312743.1 Gene:CLIPB8 / 1273740 VectorBaseID:AGAP003057 Length:405 Species:Anopheles gambiae


Alignment Length:282 Identity:77/282 - (27%)
Similarity:121/282 - (42%) Gaps:51/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDH-----VCGGSIYSENIIVTAAHCF 69
            :|.|..|.| :..:..:|.||:...|::.||...|.|..|:     .|||::.|...::|||||.
Mosquito   121 IAFDADSCG-IQSYVAKIRGGQLAEIDEFPWMAMLLYERDNNALTQGCGGALISRTYVITAAHCV 184

  Fly    70 ----FDEEGNRLDD---QGYQVRAG------SALTDSNGTLVDVA--ALIIHEEYAFDLN--IND 117
                |.:...||..   :.|.:...      :.|.|.:..::|:.  |:|.|.||..:.:  .:|
Mosquito   185 TGKNFQQTKGRLKFVRLREYNIHTNPDCVYENDLKDCSDDMIDLVPQAVIPHPEYDSESSNQQHD 249

  Fly   118 IAIVRLSTPLEFTSKVQPIPLAKTN----PYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHI 178
            ||::|:.....||..::.|.|.:.|    ..|.....|||||.:.|..|  ||.|..|..:.|.:
Mosquito   250 IALIRIEQTPPFTDFLRSICLPEQNFESSATPGKKLSVSGWGRTDIFKD--NLGPDVLSPIKLKL 312

  Fly   179 KSIFSCR------------LFDPSLLCA-GTYGRTACHGDSGGPLVVNKQ------LVGVVSWGR 224
            ...:..|            ...|..:|| |...:..|.||||.||:....      :.|:||.|.
Mosquito   313 SLPYVEREKCSKTFRPWSFALGPGQMCAGGERAKDTCAGDSGSPLMSYDMKRAIWYITGIVSLGV 377

  Fly   225 KGCVSSAF---FVSVPYFREWI 243
            :||.....   :.:|.::..||
Mosquito   378 RGCGVEGLPGVYTNVHHYLPWI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 71/264 (27%)
Tryp_SPc 27..243 CDD:238113 71/263 (27%)
CLIPB8XP_312743.1 CLIP 41..95 CDD:288855
Tryp_SPc 136..399 CDD:214473 71/264 (27%)
Tryp_SPc 139..400 CDD:238113 72/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.