DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CLIPD1

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_312523.4 Gene:CLIPD1 / 1273538 VectorBaseID:AGAP002422 Length:435 Species:Anopheles gambiae


Alignment Length:257 Identity:75/257 - (29%)
Similarity:123/257 - (47%) Gaps:41/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDD 79
            ||..|::    :|.||.|....:.||.|:|.......|||.:.::..::|||||..:     |..
Mosquito   195 LSTKQLS----KIAGGRPADSNEWPWMVALVSSRASFCGGVLITDRHVLTAAHCVMN-----LKL 250

  Fly    80 QGYQVRAG----SALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPI---P 137
            ..:.||.|    ....::......||.:..|.::......||||:::|..|..|.|.:.||   |
Mosquito   251 TQFVVRLGEYDFKQFNETRYRDFRVAEIRAHADFDQISYENDIAMLKLIQPSFFNSYIWPICMPP 315

  Fly   138 LAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC------RLFDPSLLCAGT 196
            |  .:.:....|:|:|||..:.....:.:    |..:.:.|.|...|      |::: :.||||.
Mosquito   316 L--DDAWTGYQAVVTGWGTQFFGGPHSPV----LMEVRIPIWSNQECQEVYVNRIYN-TTLCAGE 373

  Fly   197 Y--GRTACHGDSGGPLVV---NKQ--LVGVVSWGRKGCVSS---AFFVSVPYFREWIL-NAI 247
            |  |:.:|.|||||||::   |::  :||:||||.: |..:   ..:..|..:..||: ||:
Mosquito   374 YDGGKDSCQGDSGGPLMIQLPNRRWAVVGIVSWGIR-CGEANHPGIYTRVSSYVRWIIENAV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 68/239 (28%)
Tryp_SPc 27..243 CDD:238113 68/238 (29%)
CLIPD1XP_312523.4 CLIP 102..147 CDD:197829
Tryp_SPc 202..429 CDD:214473 68/239 (28%)
Tryp_SPc 203..432 CDD:238113 70/241 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.