DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CLIPD4

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_312102.4 Gene:CLIPD4 / 1273150 VectorBaseID:AGAP002811 Length:385 Species:Anopheles gambiae


Alignment Length:273 Identity:79/273 - (28%)
Similarity:125/273 - (45%) Gaps:66/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQY---FG--DHVCGGSIYSENIIVTAAHCFFDE------------- 72
            |::||.|..:...||...:.|   ||  |..||||:.::..::|||||....             
Mosquito   126 RVVGGVPAALNGWPWMALVGYEEAFGDVDFRCGGSLITDRHVLTAAHCILSSLLVWMQHDMDNQT 190

  Fly    73 EGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEY-AFDLNINDIAIVRLSTPLEFTSKVQPI 136
            |...:|...|:||:.|        :..|.:.:.|..| .|| ..:|:||:.|:..:||.::::||
Mosquito   191 ESAHVDVPVYKVRSTS--------INFVKSYVSHPSYDTFD-GHSDVAILFLTETVEFNARIKPI 246

  Fly   137 PLAKTNPYPRSI------ALVSGWGVSYILNDSTNLYPTHLQGLAL-------------HIKSIF 182
            .|....|. ||.      ..::|||    ....|.:....||.|.:             .|:.::
Mosquito   247 CLPTIEPV-RSADFTGYNPFIAGWG----RTKETGIEAKVLQELQIPILENEECSQLYKKIRKLY 306

  Fly   183 SCRLFDPSLLCAGTY--GRTACHGDSGGPL----VVNKQL----VGVVSWGRKGCVSS---AFFV 234
            |.:.||.::||||..  |:.:|.|||||||    :|||:.    :|:||:| .||..:   ..:.
Mosquito   307 STKQFDDAVLCAGFLEGGKDSCQGDSGGPLMLPYLVNKKFHYFQIGIVSYG-VGCARAELPGVYT 370

  Fly   235 SVPYFREWILNAI 247
            .|..|.:|::..|
Mosquito   371 RVVTFVDWLVGQI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/267 (29%)
Tryp_SPc 27..243 CDD:238113 76/266 (29%)
CLIPD4XP_312102.4 Tryp_SPc 126..378 CDD:214473 77/266 (29%)
Tryp_SPc 127..379 CDD:238113 76/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.