DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CLIPD6

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_312099.2 Gene:CLIPD6 / 1273147 VectorBaseID:AGAP002813 Length:484 Species:Anopheles gambiae


Alignment Length:267 Identity:71/267 - (26%)
Similarity:121/267 - (45%) Gaps:61/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQY---FGD--HVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVR 85
            |::||.|..:...||...:.|   .|:  ..||||:.::..::|||||.      |.|....::.
Mosquito   232 RVVGGVPAELNGWPWMALVGYKNTLGEVSFKCGGSLITKRHVLTAAHCI------RRDLSSVRLG 290

  Fly    86 AGSALTDSNGTLVDVAALIIHEEYAFDL--NINDIAIVRLSTPLEFTSKVQPI--PLAKT----- 141
            .....||:....:||..:......::|.  ...|:|::.:...::|:..::||  ||::|     
Mosquito   291 EHDTSTDAETKHIDVPVVRYESHPSYDKKDGHTDLAVLYMEFEVQFSDAIKPICLPLSETIRSKN 355

  Fly   142 ----NPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLAL-------------HIKSIFSCRLFDP 189
                .|:      |:|||.:.....|.|:    ||.|.:             .|..:||.:.||.
Mosquito   356 FIGYTPF------VAGWGRTQEGGKSANV----LQELQIPIIANDECRTLYDKIGKVFSQKQFDN 410

  Fly   190 SLLCAGTY--GRTACHGDSGGPLVVNKQL--------VGVVSWGRKGCVSS---AFFVSVPYFRE 241
            :::|||..  |:.:|.|||||||::.::.        ||:||:| .||..:   ..:..|..|.:
Mosquito   411 AVMCAGVIEGGKDSCQGDSGGPLMLPQRFGTEFYYYQVGIVSYG-IGCARAEVPGVYTRVASFVD 474

  Fly   242 WILNAIA 248
            ||...:|
Mosquito   475 WIQQKVA 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 68/260 (26%)
Tryp_SPc 27..243 CDD:238113 67/259 (26%)
CLIPD6XP_312099.2 CLIP 25..80 CDD:288855
CLIP 114..166 CDD:288855
Tryp_SPc 232..476 CDD:214473 68/260 (26%)
Tryp_SPc 233..479 CDD:238113 69/262 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.