DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP002842

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_312070.5 Gene:AgaP_AGAP002842 / 1273118 VectorBaseID:AGAP002842 Length:282 Species:Anopheles gambiae


Alignment Length:269 Identity:72/269 - (26%)
Similarity:108/269 - (40%) Gaps:60/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIGGEPIGIEQVPWQVSLQYF------GDHV------CGGSIYSENIIVTAAHCFFDEEGNRLDD 79
            |:||:....::.|....|...      ||.|      |||::.|:..::|||||    ....:..
Mosquito    26 IVGGDSATADEFPHMAVLGRSCLQADGGDCVDGYEWFCGGTLISDRFVLTAAHC----AHTGMSH 86

  Fly    80 QGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPY 144
            ....|:.|:.........|.|..:::|..|...|..||||::||.:|:  .|.:||..|.::...
Mosquito    87 PPTVVQLGAHDLRRPALYVGVRDVVLHPGYGGVLAYNDIALIRLESPV--ASSIQPALLWRSETI 149

  Fly   145 PRSIALV-SGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC--------RLFD---PSLLCAG-- 195
            |.::.|: :|||......|.:.:    ||.:.:.|.....|        ||..   ||.||||  
Mosquito   150 PENVPLIATGWGKLGHFEDPSMI----LQRVQIPIVPNSQCNQLLYRSRRLRHGVLPSQLCAGDP 210

  Fly   196 TYGRTACHGDSGGPL------------VVNKQLVGVVSWG-------RKGCVSSAFFVSVPYFRE 241
            ..|:..|.|||||||            .....:||:.|.|       |.|     .:..|..:..
Mosquito   211 NGGKDTCEGDSGGPLQLKLPSARPIGQAYRYYVVGITSNGGICGTVDRPG-----LYTRVSSYAG 270

  Fly   242 WILNAIASI 250
            ||...:..|
Mosquito   271 WIDQVLEQI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 69/260 (27%)
Tryp_SPc 27..243 CDD:238113 69/260 (27%)
AgaP_AGAP002842XP_312070.5 Tryp_SPc 26..275 CDD:238113 71/263 (27%)
Tryp_SPc 26..272 CDD:214473 69/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.