DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP010661

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_311381.4 Gene:AgaP_AGAP010661 / 1272469 VectorBaseID:AGAP010661 Length:175 Species:Anopheles gambiae


Alignment Length:172 Identity:50/172 - (29%)
Similarity:74/172 - (43%) Gaps:13/172 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSI 148
            :..||......|.:...:.::||..|..:.:..|.|||.:.|..:....:.||.|........:.
Mosquito     3 LHGGSTTQTRGGVIFQASKIVIHPYYNPETHDYDAAIVEIKTSFQGYDNIAPIALQDAEVPSDTT 67

  Fly   149 ALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC-----RLFDPSLLCAGTYGR-TACHGDSG 207
            ...:|||::   |......|.:||...|.:.:...|     ....|.::||..... ..|.||||
Mosquito    68 CYAAGWGLN---NYDRRTTPDNLQYATLQVITQQQCSAAWGSYATPQVICAQQNNNGDVCKGDSG 129

  Fly   208 GPLVVNKQLVGVVSWGRKGC---VSSAFF-VSVPYFREWILN 245
            ||.|.|.:|.|..|:|..||   :.|||. |:.|..||:|.|
Mosquito   130 GPFVCNGKLTGATSYGGIGCRGRLPSAFAKVTAPAIREFIRN 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 48/168 (29%)
Tryp_SPc 27..243 CDD:238113 48/168 (29%)
AgaP_AGAP010661XP_311381.4 Tryp_SPc <1..172 CDD:238113 50/172 (29%)
Tryp_SPc <1..162 CDD:214473 45/161 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.