DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP000290

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_310831.5 Gene:AgaP_AGAP000290 / 1271969 VectorBaseID:AGAP000290 Length:499 Species:Anopheles gambiae


Alignment Length:255 Identity:76/255 - (29%)
Similarity:111/255 - (43%) Gaps:49/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QRIIGGEPIGIEQVPWQVSLQYF---GDHV--CGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQV 84
            |.:.|  |:|..:.||.|::...   |.:|  |||::.:::::||||||.   ..|||....:.|
Mosquito   255 QAVAG--PVGFSEFPWTVAIHQLIRNGSYVYHCGGALLNQSVVVTAAHCV---SNNRLHPNRFVV 314

  Fly    85 RAG--------SALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFT-SKVQPIPLAK 140
            .||        ..|.....|   |:.:::|..|......||:|::..|.|...| :.|:|:.|:.
Mosquito   315 YAGDWDRRHTQERLPHQERT---VSRVLVHPNYYSGALFNDLALLFFSEPFNDTVANVEPVCLSS 376

  Fly   141 ---TNPYPRSIALVSGWGVSYILNDSTNLY-------------PTHLQGLALHIKSIFSCRLFDP 189
               |:..|.....|:|||.|...|.:.::.             .|.||.|.. :.|.|.   ...
Mosquito   377 PSGTDYIPPDNCFVTGWGGSPKGNRAQSIQQYSKLQLVERHRCETQLQSLPT-LGSKFK---LHQ 437

  Fly   190 SLLCAGTYGRTACHGDSGGPLVVNKQ----LVGVVSWGRKGCVSS--AFFVSVPYFREWI 243
            |.:||.|.|...|.|..|.|....:.    |||:|||| .||...  |...:|...||||
Mosquito   438 SFVCAATDGTDVCQGSGGSPYACERDGRYYLVGIVSWG-VGCGDGIPAVLTNVTELREWI 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 73/252 (29%)
Tryp_SPc 27..243 CDD:238113 73/251 (29%)
AgaP_AGAP000290XP_310831.5 Tryp_SPc 265..499 CDD:238113 72/243 (30%)
Tryp_SPc 265..496 CDD:214473 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.