DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CLIPC4

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_310504.4 Gene:CLIPC4 / 1271649 VectorBaseID:AGAP000573 Length:376 Species:Anopheles gambiae


Alignment Length:223 Identity:65/223 - (29%)
Similarity:91/223 - (40%) Gaps:41/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GDHV----CGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEE 108
            |:.|    ||.|:.:...::|||||..|.....::....|      |:|:.....::..:.:||.
Mosquito   159 GEEVKLTRCGASLIAPRFLLTAAHCLKDLNPVTVEIGFIQ------LSDTEKDEYEIKQVHLHEG 217

  Fly   109 YAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPY--PRSIALVSGWGVSYILNDSTNLYPTHL 171
            :  ....||||::.|...:.:...|.||.|....|.  |.....|.|||.......:..|    :
Mosquito   218 H--KSRRNDIALIELKNNVTYKQDVGPICLNTDRPEIGPSINLTVMGWGADGDGQRADKL----M 276

  Fly   172 QGLALHIKSIFSC--RLFDP----SL----LCA-----GTYGRTACHGDSGGPLVVNKQ----LV 217
            :|....| .:..|  |..|.    ||    |||     ......||.||||||||:..:    ||
Mosquito   277 KGTVYEI-PLDECVQRFRDAKQRISLGEDQLCALGEKVNDETTDACQGDSGGPLVMTVRQKFYLV 340

  Fly   218 GVVSWGRKGCVSS--AFFVSVPYFREWI 243
            ||||.|.. |..|  ..:..|..:.|||
Mosquito   341 GVVSTGAV-CGGSLPGIYTRVSRYLEWI 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 63/221 (29%)
Tryp_SPc 27..243 CDD:238113 63/221 (29%)
CLIPC4XP_310504.4 Tryp_SPc 140..369 CDD:238113 65/223 (29%)
Tryp_SPc 140..367 CDD:214473 63/221 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.